PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G072800.1
Common NamePHAVU_003G072800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 207aa    MW: 23087.1 Da    PI: 9.1816
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G072800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-1369113347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++ + +  G+g+W+ I+r + k+Rt+ q+ s+ qky
  Phvul.003G072800.1  69 PWTEEEHRQFLLGLENVGKGDWRGISRNFVKTRTPTQVASHAQKY 113
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.48862118IPR017930Myb domain
SuperFamilySSF466893.29E-1763117IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-1765116IPR006447Myb domain, plants
SMARTSM007175.1E-966116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1068113IPR009057Homeodomain-like
CDDcd001674.10E-969114No hitNo description
PfamPF002491.6E-1069113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MCAAEKDGIM LFGVRLTVSD NNPTSLRKSA SMNNLPPYSE SPPPHHRNAG YASDDVIHLC  60
RRTRKPGVPW TEEEHRQFLL GLENVGKGDW RGISRNFVKT RTPTQVASHA QKYFLRRHTH  120
NLQRRRSSLF DITTDSVKED EQTVPSARLK PVLPAPPSLK MDELELNGRS VWLKLRLPEP  180
EEPSPATSEV VSNGNLSGDG DMITVA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150343e-91AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153882.11e-153hypothetical protein PHAVU_003G072800g
SwissprotQ2V9B01e-37MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLV7CAD31e-153V7CAD3_PHAVU; Uncharacterized protein
STRINGGLYMA18G17143.15e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-49MYB_related family protein